PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN35035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 642aa    MW: 71618.7 Da    PI: 6.4672
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN35035.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.13.1e-084184551954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps  ++  LA+++gL+  qV++WF N R +
  KHN35035.1 418 FEHflHPYPSDVDKHILARQTGLSRGQVSNWFINARVR 455
                 554459******************************88 PP

2BELL117.37.4e-38280350272
        BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 + elqk+k+kLls+leeVd+rYk+y++q++ v+ssFeavag g+a++Y +lAlka+SrhFrcLkd i +qi
  KHN35035.1 280 FVELQKRKTKLLSMLEEVDRRYKHYRNQMKSVVSSFEAVAGNGAATVYSALALKAMSRHFRCLKDGILSQI 350
                 679******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.8E-54216348IPR006563POX domain
PfamPF075262.4E-45222346IPR006563POX domain
PROSITE profilePS5007111.758396459IPR001356Homeobox domain
CDDcd000863.57E-11399460No hitNo description
SMARTSM003891.4E-8399463IPR001356Homeobox domain
SuperFamilySSF466891.07E-16400466IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-27402465IPR009057Homeodomain-like
PfamPF059204.3E-17416455IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MARQVCDDKL STGFCYSDVS SGNPTMLVNQ IQGFVSDPEM YNLTTGMEMI GFPKSDTNAV  60
MWRSFIPEPG PSSSKTINDS STTFYHHDYN NKNADFTPAG NISETSAENL IVGNHDSAPW  120
QDNNNNRFDD SSLRCVFPCE TNERPSQGLS LSLSSTNPST IGLQSFELRQ TGHHPDFVSS  180
SSREGFFGKP VSLQQQQMLS QDGYVSSNSK VASVYQQGHF LVKNSKFLVP AQDLLNEFCS  240
LCAKQSDLGK PTKSLKKQWE DQENNGVGSS KKHSLTSLEF VELQKRKTKL LSMLEEVDRR  300
YKHYRNQMKS VVSSFEAVAG NGAATVYSAL ALKAMSRHFR CLKDGILSQI QATRKAMGEK  360
DPVAPGTTRG ETPRLKVIDQ TLRQQRAFQQ MSMMETHPWR PQRGLPERAV SVLRAWLFEH  420
FLHPYPSDVD KHILARQTGL SRGQVSNWFI NARVRLWKPM VEEMYLEEVK DPENNIASSE  480
GATDQDNDIN PNNVQYPPPP LSSRSEDQKP SLVRIDSECA SSIINNHSTP DNKNDPKGQE  540
QCFGSVELDF SSYTHHSSGM VSYGSSDQNG NNNQSGVSLT LGLQQHGVSL AFPPATQSSL  600
YYPRDQIEDC QPVHQYSLLD GEGQNLPYRN LMGAQLLHDL AG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A8e-16405463563Homeobox protein Meis2
4xrm_B8e-16405463563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538310.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_006590505.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-139BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A0B2RPM10.0A0A0B2RPM1_GLYSO; Homeobox protein BEL1 like
STRINGGLYMA11G02450.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-138TALE family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]